DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wry and F10

DIOPT Version :10

Sequence 1:NP_995611.2 Gene:wry / 33361 FlyBaseID:FBgn0051665 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:162 Identity:48/162 - (29%)
Similarity:60/162 - (37%) Gaps:72/162 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 CVHGICVDQEDGFRCFCQPGFAGELCNFEYNE--------------CESNPCQNGGECIDHIGSY 876
            ||..||..:|           |.|:  ||.||              |||:||||.|||.|.:|||
  Rat    57 CVEEICSFEE-----------AREV--FEDNEKTTEFWNKYEDGDQCESSPCQNQGECRDGLGSY 108

  Fly   877 ECRCTKGFSGNRCQIKVDFCANKPCPEGHRCIDHGNDFSCECPGGRNGPDCNQMPRTYFQQCNVN 941
            .|.||:||.|..|::.|    .|.|     .:|:|              ||:|.           
  Rat   109 TCTCTEGFEGKNCELFV----RKLC-----SLDNG--------------DCDQF----------- 139

  Fly   942 PCTHGGTCWSSGDSFYCACRPGY----TGTMC 969
                   |....:|..|:|..||    .|..|
  Rat   140 -------CREEQNSVVCSCAKGYFLGNDGKSC 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wryNP_995611.2 EGF_CA 737..777 CDD:238011
EGF 783..812 CDD:394967
EGF_CA 819..851 CDD:238011 7/24 (29%)
EGF_CA 856..890 CDD:238011 22/47 (47%)
EGF_CA 893..927 CDD:238011 5/33 (15%)
EGF 938..966 CDD:394967 6/31 (19%)
F10NP_058839.1 GLA 23..84 CDD:214503 11/39 (28%)
EGF_CA 86..122 CDD:238011 20/35 (57%)
FXa_inhibition 129..164 CDD:464251 13/71 (18%)
Tryp_SPc 232..462 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.