DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wry and dsl-4

DIOPT Version :9

Sequence 1:NP_995611.2 Gene:wry / 33361 FlyBaseID:FBgn0051665 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_001359594.1 Gene:dsl-4 / 184563 WormBaseID:WBGene00001106 Length:368 Species:Caenorhabditis elegans


Alignment Length:277 Identity:76/277 - (27%)
Similarity:112/277 - (40%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 VTLYDKDLTEGVNLLIVVSELWGAQCVRLKVTTKTDN---------CGENADCSGKGVCYSNSGM 718
            :::||.:..|.:.|..:|..| ........|.||.|:         |.||.......:...:...
 Worm    81 ISIYDINDEEPLGLEQIVVPL-TRHFSNFTVHTKNDSFLHFAVRNVCDENWRTHSCSIFCKDRSD 144

  Fly   719 EEYEC------QCCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQ 777
            .:::|      :|..|::||:|:::|.  |..|.|:|.|....        :|:|..|:.|..|:
 Worm   145 SKFKCDDDDGYKCAPGYSGPNCDKVDC--PFNCHNHGSCEVPG--------KCMCSQGFFGTYCE 199

  Fly   778 YESDPCNPA-ECMNGGSCVGN-STH-FRCDCAPGFTG------PLCQHSLNECESSPCVHGICVD 833
            |    |.|: .|.:|...|.. ..| :.|.|..|:.|      .:|.:      :.||.||.||.
 Worm   200 Y----CKPSTTCKHGAVLVNELGCHPYTCRCFEGYAGDNGDKDDVCYY------AKPCRHGNCVS 254

  Fly   834 Q---EDGFRCFCQPGFAGELCN---FEYNECESNPCQNGGECIDHIGSYECRCTKGFSGNRCQIK 892
            .   ..||.|.|...|.|..|.   ..::..:...|||.|.|....|...|||..||:|..|:.|
 Worm   255 NVTVSGGFECICPKAFGGRRCEKRIARWDCSDEGYCQNKGVCSFVDGISRCRCAVGFTGKHCERK 319

  Fly   893 -VDFCANKPCPEGHRCI 908
             ...|..|.|.||..||
 Worm   320 TAKTCLKKKCREGFICI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wryNP_995611.2 EGF_CA 737..777 CDD:238011 10/39 (26%)
EGF 783..812 CDD:278437 10/37 (27%)
EGF_CA 819..851 CDD:238011 12/34 (35%)
EGF_CA 856..890 CDD:238011 12/33 (36%)
EGF_CA 893..927 CDD:238011 7/16 (44%)
EGF_CA <941..970 CDD:238011
dsl-4NP_001359594.1 DSL 110..166 CDD:366627 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.