DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wry and NOTCH2NLC

DIOPT Version :9

Sequence 1:NP_995611.2 Gene:wry / 33361 FlyBaseID:FBgn0051665 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_001350942.1 Gene:NOTCH2NLC / 100996717 HGNCID:53924 Length:293 Species:Homo sapiens


Alignment Length:311 Identity:101/311 - (32%)
Similarity:141/311 - (45%) Gaps:60/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 GENAD------CSGKGVCYSNSGMEEYECQCCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHE 759
            |:..|      |.|:  |:.:.........|..|:             .||.|.|:||..   |.
Human    18 GDREDARPAPLCCGR--CWRSGCAARPPRMCRDGY-------------EPCVNEGMCVTY---HN 64

  Fly   760 GNSYQCLCPYGYAGKNCQYESDPCNPAECMNGGSCV-----GNSTHFRCDCAPGFTGPLCQHSLN 819
            |..| |.||.|:.|:.||:. |||....|.|||:||     |.:|   |.||.||||..||:|.:
Human    65 GTGY-CKCPEGFLGEYCQHR-DPCEKNRCQNGGTCVAQAMLGKAT---CRCASGFTGEDCQYSTS 124

  Fly   820 E-C-ESSPCVH-GIC-VDQEDGFRCFCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSYECRC 880
            . | .|.||:: |.| :...|.:.|.||.||.|:.|.:. :.|.|:||.||..|......:.|:|
Human   125 HPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWT-DACLSHPCANGSTCTTVANQFSCKC 188

  Fly   881 TKGFSGNRCQIKVDFCANKP--CPEGHRCIDHGNDFSCECPGGRNGPDCNQMPRTYFQQCNVNPC 943
            ..||:|.:|:..|:.| :.|  |..|..|::....:.|:|..|..|..|:.:    :..|..:||
Human   189 LTGFTGQKCETDVNEC-DIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSL----YVPCAPSPC 248

  Fly   944 THGGTCWSSGD-SFYCACRPGYTGTMCEDEFVVETVVSSSEFIVDDANARN 993
            .:||||..:|| :|.|.|.|             |||...:|....|....|
Human   249 VNGGTCRQTGDFTFECNCLP-------------ETVRRGTELWERDREVWN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wryNP_995611.2 EGF_CA 737..777 CDD:238011 14/39 (36%)
EGF 783..812 CDD:278437 15/33 (45%)
EGF_CA 819..851 CDD:238011 13/35 (37%)
EGF_CA 856..890 CDD:238011 12/33 (36%)
EGF_CA 893..927 CDD:238011 10/35 (29%)
EGF_CA <941..970 CDD:238011 12/29 (41%)
NOTCH2NLCNP_001350942.1 EGF_CA 200..236 CDD:238011 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.