DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wry and sned1

DIOPT Version :9

Sequence 1:NP_995611.2 Gene:wry / 33361 FlyBaseID:FBgn0051665 Length:1157 Species:Drosophila melanogaster
Sequence 2:XP_012826283.1 Gene:sned1 / 100498350 XenbaseID:XB-GENE-940133 Length:1667 Species:Xenopus tropicalis


Alignment Length:433 Identity:140/433 - (32%)
Similarity:184/433 - (42%) Gaps:88/433 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 TTEHCKPDEHCVPNVLTWRGEAEIQSGDILIVEINDAMLNPSHEPNNTSSAVHATQVYQVTRSGH 639
            |...|:....|:.:.:|.                     |||:    |.|.:          ||.
 Frog   269 TLRPCQNGGRCIDDCVTG---------------------NPSY----TCSCL----------SGF 298

  Fly   640 --EHCDVTEGVLLDITPLVVDGRKLVTLYDKDLTEGVNLLIVVSELWGAQCVRLKVTTKT----D 698
              :||.:..|.... .|...||    |..|:   .|....:..|:..|..| ..:|:..|    .
 Frog   299 TGKHCHIDMGKCYS-QPCQNDG----TCVDE---PGSFTCLCTSDFTGTLC-ETEVSPCTYMTCH 354

  Fly   699 NCGENADCSGKGVC-----YS-----------------NSGMEE-----YECQCCSGFAGPHCE- 735
            |.||..|.:|..||     |:                 |.|..|     :.|||..||.|.||| 
 Frog   355 NGGECEDHNGIAVCVCQRGYTGDNCDTELLPCSSSPCLNGGSCENIDAGFRCQCALGFTGTHCEK 419

  Fly   736 EIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYESDPCNPAECMNGGSCVGNSTH 800
            |..||..|||.|||:|.|:..|     |.|:|..|:.|..|:.|..||:.|.|:|.|.|..|...
 Frog   420 EPSACFSSPCMNNGVCKDVGAG-----YICVCVQGFTGMYCETEIRPCSSAPCLNRGVCRENGET 479

  Fly   801 FRCDCAPGFTGPLCQHSLNECESSPCVH-GICVDQEDGFRCFCQPGFAGELCNFEYNECESNPCQ 864
            :.|.||..|||..|:..:..|.|:||:: |.|.|..:|:.|.|..|:.|..|..|...|.|:||.
 Frog   480 YSCQCARRFTGKHCETEIRPCFSNPCMNMGTCEDMSEGYSCICTEGYTGIHCETELRPCYSSPCL 544

  Fly   865 NGGECIDHIGSYECRCTKGFSGNRCQIKVDFCANKPCPEGHRCIDHGNDFSCECPGGRNGPDCNQ 929
            ||..|.|...:|.|.|..||:|.||:.::..|.:.||..|..|.|.|..:||:|..|..|..|  
 Frog   545 NGALCKDFGITYSCVCAWGFTGARCETELHPCFSSPCLNGATCRDVGFAYSCQCAQGFTGMHC-- 607

  Fly   930 MPRTYFQQCNVNPCTHGGTCWSSGDSFYCACRPGYTGTMCEDE 972
              .|..:.|..:||.:||||.....||.|.|...|||..||.|
 Frog   608 --ETEIKPCFSSPCLNGGTCEDLAISFACLCAERYTGLHCETE 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wryNP_995611.2 EGF_CA 737..777 CDD:238011 16/39 (41%)
EGF 783..812 CDD:278437 12/28 (43%)
EGF_CA 819..851 CDD:238011 12/32 (38%)
EGF_CA 856..890 CDD:238011 15/33 (45%)
EGF_CA 893..927 CDD:238011 12/33 (36%)
EGF_CA <941..970 CDD:238011 13/28 (46%)
sned1XP_012826283.1 NIDO 99..251 CDD:214712
EGF_CA 267..303 CDD:238011 11/68 (16%)
EGF_CA <314..342 CDD:238011 9/35 (26%)
EGF_CA 387..418 CDD:238011 10/30 (33%)
EGF_CA <427..456 CDD:238011 14/33 (42%)
EGF 462..492 CDD:278437 13/29 (45%)
EGF_CA <503..532 CDD:238011 10/28 (36%)
EGF_CA <579..608 CDD:238011 12/32 (38%)
EGF_CA <617..646 CDD:238011 13/28 (46%)
EGF 652..682 CDD:278437
EGF_CA 690..721 CDD:238011
EGF_CA 730..761 CDD:238011
EGF_CA 841..873 CDD:238011
EGF_CA 881..912 CDD:238011
EGF_CA 920..951 CDD:238011
CCP 957..1011 CDD:153056
EGF_CA 1013..1048 CDD:238011
EGF_CA 1052..1086 CDD:238011
EGF_CA 1089..1124 CDD:238011
fn3 1176..1244 CDD:278470
fn3 1262..1344 CDD:278470
FN3 1360..1448 CDD:238020
MAGP <1594..1641 CDD:283223
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D7525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.