DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and MAPR4

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_567451.1 Gene:MAPR4 / 827155 AraportID:AT4G14965 Length:245 Species:Arabidopsis thaliana


Alignment Length:176 Identity:45/176 - (25%)
Similarity:76/176 - (43%) Gaps:34/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PLGQALVSFLVGY-FVTTKLSQFYGKFKRDSEKSDESTQYLDMYPRKESQPKDTKGHDIVLLTLE 89
            |..:.|:|..||. |:...:|.::    |.|.||          |:.:.|.:        |.:.|
plant     3 PARRFLLSPFVGVTFIVVLVSLYF----RSSFKS----------PQHQYQKR--------LFSAE 45

  Fly    90 ELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVL--------NIACSSM 146
            ||..::|:..:|||...:.|.::|::.|:..:.|.|.|:..||.:|::..        .:..|..
plant    46 ELALYNGTDETLPILLGILGSVFDVTKGKFHYGSGGGYNHFAGRDASRAFVSGNFTGDGLTDSLQ 110

  Fly   147 GVCAANV--ISRWEQSLRAEFKVVGYLVDADIDIISGSPVKHTNSA 190
            |:.::.|  |..|.......:..||.||....| ..|:|.||...|
plant   111 GLSSSEVKSIVDWRGFYSRTYTPVGKLVGRYYD-SQGNPTKHLKGA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 9/27 (33%)
MAPR4NP_567451.1 Cyt-b5 41..>95 CDD:278597 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1355837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.