DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and MAPR3

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_190458.1 Gene:MAPR3 / 824050 AraportID:AT3G48890 Length:233 Species:Arabidopsis thaliana


Alignment Length:214 Identity:50/214 - (23%)
Similarity:83/214 - (38%) Gaps:60/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGQALVSFLVGYFVTTKLSQFYGKFKRDSEKSDESTQYLDMYPRKESQPKDTKGHDIVLLTLEEL 91
            |..|:...:.|:||:.::.:               .:.|::.|:.|..|...:..:|   |.|||
plant    30 LAFAVYQVVSGFFVSPEVHR---------------PRSLEVQPQSEPLPPPVQLGEI---TEEEL 76

  Fly    92 TAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVL------------NIACS 144
            ..:|||....|:..|:.|.|||:|..|..:...|||:|.||.:|::.|            :|  |
plant    77 KLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEDQDLTGDI--S 139

  Fly   145 SMGVCAANVISRWEQSLRAEFKVVGYLVDAD-------------------IDIISG---SPVKH- 186
            .:|......:..||....:::..||.:...|                   :...:|   |.:.| 
plant   140 GLGAFELEALQDWEYKFMSKYVKVGTIQKKDGEGKESSEPSEAKTASAEGLSTNTGEEASAITHD 204

  Fly   187 -----TNSAIGEQMEKSDI 200
                 |...|.|..||.|:
plant   205 ETSRSTGEKIAETTEKKDV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 13/27 (48%)
MAPR3NP_190458.1 Cyt-b5 72..>133 CDD:395121 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10281
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.