DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and cyb5d2

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001096144.1 Gene:cyb5d2 / 795950 ZFINID:ZDB-GENE-050506-83 Length:267 Species:Danio rerio


Alignment Length:99 Identity:23/99 - (23%)
Similarity:44/99 - (44%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VLLTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKV---------- 138
            :|||.|:|:.::|...|..:|.|:.|.::|:..||:.:...|.|....|.:|::.          
Zfish    52 LLLTKEQLSLYNGGKNSKGLYLAILGQVFDVEKGRKHYGPGGGYHFFTGKDASRAFITGDFTEAG 116

  Fly   139 LNIACSSMGVCAANVISRWEQSLRAEFKVVGYLV 172
            |:...|.........:..|....:.::..||.|:
Zfish   117 LSNDVSDFSESQIVALYDWLSFYQRDYTPVGKLI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 9/27 (33%)
cyb5d2NP_001096144.1 Cyt-b5 55..124 CDD:278597 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1355837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.