DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and Nenf

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_079700.1 Gene:Nenf / 66208 MGIID:1913458 Length:171 Species:Mus musculus


Alignment Length:120 Identity:30/120 - (25%)
Similarity:62/120 - (51%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KGHDIVLLTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVL---- 139
            :|..:.|.|.|||..:.|.....|||.|:.|:::|::.|:|.:....||:.|||.::::.:    
Mouse    39 RGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMS 103

  Fly   140 ----NIACSSMGVCAANVISR---WEQSLRAEFKVVGY----LVDADIDIISGSP 183
                ::...:.|:.|..:.:.   :.:..:|::.:|||    :::.|     |||
Mouse   104 LDPADLTHDTTGLTAKELEALDDVFSKVYKAKYPIVGYTARRILNED-----GSP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 11/27 (41%)
NenfNP_079700.1 Cyt-b5 45..>100 CDD:278597 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2235
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.