DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and nenf

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001032793.2 Gene:nenf / 571299 ZFINID:ZDB-GENE-050320-129 Length:158 Species:Danio rerio


Alignment Length:121 Identity:34/121 - (28%)
Similarity:59/121 - (48%) Gaps:30/121 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LLTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVL--------NI 141
            |.|.|||..:|||....|||.|:.|:::|::.|:|.:....||:.|.|.::.:.:        ::
Zfish    32 LFTDEELQRYDGSEDGQPIYMAIKGVVFDVTTGKEFYKKGAPYNALVGKDSTRAVAKMSLDPADL 96

  Fly   142 ACSSMGVCAANVISRWEQSL--------RAEFKVVGY----LVDADIDIISGSPVK 185
            ...:.|:..:.:     |||        :.::.||||    |::.|     |||.|
Zfish    97 THDTTGLTESQL-----QSLEKIFTGTYKTKYPVVGYTSRRLLNED-----GSPNK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 13/27 (48%)
nenfNP_001032793.2 Cyt-b5 32..>87 CDD:278597 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10281
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17353
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.