DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and cyb5d2

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001016154.1 Gene:cyb5d2 / 548908 XenbaseID:XB-GENE-981419 Length:273 Species:Xenopus tropicalis


Alignment Length:122 Identity:32/122 - (26%)
Similarity:55/122 - (45%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LLTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANK------------ 137
            |::.|||:.:||...|..||.|:.|.::|:..|.:.:...|.||..||.:|::            
 Frog    46 LMSKEELSVYDGGPGSSGIYLAILGQVFDVHKGSKHYGPGGSYSFFAGKDASRAYMTGDFTEKGL 110

  Fly   138 ---VLNIACSSMGVCAANVISRWEQSLRAEFKVVGYLVDADIDIISGSPVKHTNSAI 191
               |..::...| :...|.:|.::|:.....|:.|...|.     ||:|.|....|:
 Frog   111 VDDVTELSPLQM-LHLHNWLSFYQQNYITIGKLTGRFYDE-----SGNPTKALEDAL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 11/27 (41%)
cyb5d2NP_001016154.1 Cyt-b5 48..>109 CDD:365921 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1355837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.