DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and Pgrmc1

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_058063.2 Gene:Pgrmc1 / 53328 MGIID:1858305 Length:195 Species:Mus musculus


Alignment Length:184 Identity:42/184 - (22%)
Similarity:73/184 - (39%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PAKL-GPNLMTASKVLKSPLGQALVSFLVGYFVTTKLSQFYGKFKRD-----SEKSDESTQYLDM 67
            |::| |..|:  .::..|||...|:...:  |:..|:      .:.|     .:..|:....|..
Mouse    13 PSELEGGGLL--HEIFTSPLNLLLLGLCI--FLLYKI------VRGDQPGASGDNDDDEPPPLPR 67

  Fly    68 YPRKESQPKDTKGHDIVLLTLEELTAFDG-SSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLA 131
            ..|::..|             .||..||| ..|.  |..|:||.::|::.||:.:...|||.:.|
Mouse    68 LKRRDFTP-------------AELRRFDGVQDPR--ILMAINGKVFDVTKGRKFYGPEGPYGVFA 117

  Fly   132 GCNANKVLNIAC-------------SSMGVCAANVISRWEQSLRAEFKVVGYLV 172
            |.:|::.|...|             |.:.......:|.|:.....::..||.|:
Mouse   118 GRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 11/28 (39%)
Pgrmc1NP_058063.2 Cyt-b5 72..136 CDD:278597 22/78 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.