DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and pgrmc2

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_998269.1 Gene:pgrmc2 / 406378 ZFINID:ZDB-GENE-040426-2102 Length:201 Species:Danio rerio


Alignment Length:164 Identity:36/164 - (21%)
Similarity:67/164 - (40%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGQALVSFLVGYFVTTKLSQFYGKFKR----DSEKSDESTQYLDMYPRKESQPKDTKGHDIVLLT 87
            ||..|::..|...|.......|.::.|    |..:..|::      |..:.:.:|        .|
Zfish    32 LGGMLLNLSVLVLVLAACYVLYARWWRRAGADLGRGSEAS------PLPKMRRRD--------FT 82

  Fly    88 LEELTAFDG-SSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVLNIAC-------- 143
            |::|..:|| .:|.  |..|:|..::|::.|::.:...|||.:.||.:|::.|...|        
Zfish    83 LQQLRDYDGVQNPR--ILMAVNTKVFDVTSGKKFYGREGPYGIFAGRDASRGLATFCLEKDALRD 145

  Fly   144 -----SSMGVCAANVISRWEQSLRAEFKVVGYLV 172
                 |.:.......:..||.....::..||.|:
Zfish   146 EYDDLSDLNAVQMESVREWEMQFMEKYDYVGRLL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 10/28 (36%)
pgrmc2NP_998269.1 Cyt-b5 80..178 CDD:278597 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.