DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and Tango5

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001162716.1 Gene:Tango5 / 326232 FlyBaseID:FBgn0052675 Length:530 Species:Drosophila melanogaster


Alignment Length:82 Identity:12/82 - (14%)
Similarity:35/82 - (42%) Gaps:31/82 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 IACSSM--------GV-CAANVISRW-------------EQSLRAEFKVVGY---LVDADIDIIS 180
            :||:|:        |: |...::..|             :..::..|.::.:   |::..:|:::
  Fly   358 LACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAVIKMHIQKIFVIIAFNETLIERAVDLLA 422

  Fly   181 GSPVKHTNSAIGEQMEK 197
            ..||      :|.::::
  Fly   423 TLPV------LGHKLQE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147
Tango5NP_001162716.1 SNARE_assoc <346..395 CDD:294297 6/36 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.