DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and t-cup

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_723757.1 Gene:t-cup / 318986 FlyBaseID:FBgn0051858 Length:216 Species:Drosophila melanogaster


Alignment Length:113 Identity:33/113 - (29%)
Similarity:49/113 - (43%) Gaps:1/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VLLTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVLNIACSSMGV 148
            :.|.|::|..|||:.....|..||.|.|||:|...|:|...|..|.:||.:....|.....:.. 
  Fly    57 IKLNLDQLLGFDGTRSDGRILVALRGKIYDVSSDFEEFGLTGTLSHVAGRDFTNYLKSIMDTHN- 120

  Fly   149 CAANVISRWEQSLRAEFKVVGYLVDADIDIISGSPVKHTNSAIGEQME 196
            ...|.:.|||..|...:..||.::|...:.:.|....|....:.|..|
  Fly   121 SEINYVDRWESILETNYSCVGEVIDEQGNPLMGKIENHDVDVMEETEE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 12/27 (44%)
t-cupNP_723757.1 Cyt-b5 72..143 CDD:278597 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.