DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and Cyb5d2

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001020097.2 Gene:Cyb5d2 / 192986 MGIID:2684848 Length:263 Species:Mus musculus


Alignment Length:135 Identity:31/135 - (22%)
Similarity:52/135 - (38%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVLLTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVL-------- 139
            |.|...|||..:.|......:|.||.|.:||:|.||..:.....||..||.:|::..        
Mouse    35 IRLFLPEELARYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGAHYSGFAGRDASRAFVTGDYSEA 99

  Fly   140 NIACSSMGVCAANVIS--RWEQSLRAEFKVVGYLV----------DADIDIISGSPVKHTNSAIG 192
            .:.....|:.::.:::  .|.......:..||.||          .:::..:.....|...:...
Mouse   100 GLVDDINGLSSSEILTLHNWLSFYEKNYVFVGRLVGRFYRKDGLPTSELTQVEAMVTKGMEANEQ 164

  Fly   193 EQMEK 197
            ||.||
Mouse   165 EQREK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 10/27 (37%)
Cyb5d2NP_001020097.2 Cyt-b5 37..>91 CDD:278597 19/53 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.