DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c-cup and PGRMC2

DIOPT Version :9

Sequence 1:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_006311.3 Gene:PGRMC2 / 10424 HGNCID:16089 Length:223 Species:Homo sapiens


Alignment Length:127 Identity:31/127 - (24%)
Similarity:56/127 - (44%) Gaps:21/127 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TLEELTAFDGS-SPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVLNIAC------- 143
            :||:|..:||| :|.  |..|:||.::|::.|.:.:...|||.:.||.:|::.|...|       
Human   104 SLEQLRQYDGSRNPR--ILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALR 166

  Fly   144 ------SSMGVCAANVISRWEQSLRAEFKVVGYLVDADIDIISGSPVKHTNSAIGEQMEKSD 199
                  |.:.......:..||...:.::..||.|:..     ...|.::|:....:...|.|
Human   167 DEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKP-----GEEPSEYTDEEDTKDHNKQD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 12/28 (43%)
PGRMC2NP_006311.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..223 3/25 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.