DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17712 and blvra

DIOPT Version :9

Sequence 1:NP_608619.1 Gene:CG17712 / 33356 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001070069.1 Gene:blvra / 767661 ZFINID:ZDB-GENE-060929-312 Length:292 Species:Danio rerio


Alignment Length:297 Identity:65/297 - (21%)
Similarity:110/297 - (37%) Gaps:87/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GVGVFGTGEIANVLVPL-------LREKGFEVRAIWGRTLKE---AKETATTQNVQFHTNVIDDV 58
            |:|:.|:..:.:::.||       :..:||..|    |:|::   .|:.:.|           :.
Zfish     8 GIGIAGSVRMRDLMAPLSSSAAEQISIRGFVSR----RSLEDQQGVKQISMT-----------EA 57

  Fly    59 LLRKDVDLVFIVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYYPTLISLVNHP 123
            |.|.|:.:.||..:...|.|...:.|..||||..:.|..|....|:.:...:| ...|:....|.
Zfish    58 LSRDDIHVAFICTENTSHEENIRQFLEAGKHVCVEYPMTLSHTSAVDLWNLAQ-QKGLVLHEEHI 121

  Fly   124 LRFLPAFTHMR-----RCLQEELIGSIGDVVLMDVRVQMGTLFPE-----KYNWMCDAQMGGGAL 178
            ..|.|.|..::     :.|:|..:...|.    .::...|  ||.     :..|:         :
Zfish   122 ELFTPDFKQLKKDISGKTLEEGKLHFTGG----PLKANFG--FPSFSGIARLTWL---------V 171

  Fly   179 NLVGSV----VDLV-----------TFLLQQQAIRVHGVLRSYTKTTPAINGIRQITAPDFCNFQ 228
            .|.|.:    ||||           ..||.||    |..|....:..|.:...:.:   :| .||
Zfish   172 VLFGELTVTSVDLVEEKENKYMKMTAHLLTQQ----HKPLTWIEERGPGLGRAKHV---EF-RFQ 228

  Fly   229 ----MELASGTLVTVALHSHTVPAKAFSQEVLIYGSK 261
                .||.:|....|.|         |.|::|::..|
Zfish   229 DVTITELPAGQREPVGL---------FMQDLLLFCRK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17712NP_608619.1 MviM 5..364 CDD:223745 64/296 (22%)
blvraNP_001070069.1 MviM 1..>146 CDD:223745 35/153 (23%)
GFO_IDH_MocA 5..120 CDD:279716 29/127 (23%)
Biliv-reduc_cat 128..237 CDD:286275 26/131 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.