DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17712 and zgc:154075

DIOPT Version :9

Sequence 1:NP_608619.1 Gene:CG17712 / 33356 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001073433.1 Gene:zgc:154075 / 556929 ZFINID:ZDB-GENE-060929-910 Length:430 Species:Danio rerio


Alignment Length:323 Identity:67/323 - (20%)
Similarity:110/323 - (34%) Gaps:101/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KDVDLVFIVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYYPTLISLVNHPLRF 126
            |..|.|.|.....||.:.:|.....|.|::.:||..:.:||..::|.|. ....:|..|.|.||:
Zfish    69 KFADAVLICTPDRLHKDPAVALAKKGYHILLEKPMAVTEQDCTEIVEAI-IQNGVIFAVGHVLRY 132

  Fly   127 LPAFTHMRRCLQEELIGSIGDVVLMDVRVQMGTL-FPEKY---NWMCDAQMGGGALNLVGSVVDL 187
            .|....::..:..   |::|||:.:.....:|.. |...:   ||..:|:.....|......:||
Zfish   133 DPVIHKIKLLIDS---GAVGDVIHIQHLEPVGFYHFAHSFVRGNWRNEAESSFALLAKSCHDLDL 194

  Fly   188 V-TFLLQQQAIRV--HGVLRSYTK----------------------------------------- 208
            : .:...::.|:|  .|.|..:||                                         
Zfish   195 IHHWAGGRRCIKVSSFGSLSHFTKENKPKEAANRCLDCPVEGDCAYSAKKIYLDRVKKGAVGWPV 259

  Fly   209 ------TTPAINGIRQI--TAP----------DFCNFQ---MELASGTLVTVALHSHTVPAKAFS 252
                  :.|.|..:.:.  |.|          |.|:.|   ||...|......:       .||:
Zfish   260 SVICSNSLPDIESVTEALRTGPYGRCVYDCDNDVCSNQVVNMEFEGGLTAAFTM-------VAFT 317

  Fly   253 QEV-----LIYGSKGHLVVRGGDLFV---LKEGQPKEEAVYVDVQDLHFATNNSLLPRPYIKG 307
            :|:     .||||||.|...|.::.|   |.....|.             |::..:|..:.||
Zfish   318 KEICNRKTTIYGSKGELTCDGHEITVFDFLSNKTTKH-------------TSDGTVPGNFAKG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17712NP_608619.1 MviM 5..364 CDD:223745 67/323 (21%)
zgc:154075NP_001073433.1 GFO_IDH_MocA 7..128 CDD:279716 17/59 (29%)
MviM 9..>208 CDD:223745 34/142 (24%)
GFO_IDH_MocA_C 140..>214 CDD:304482 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590291
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1924
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.