DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17712 and dhdh.2

DIOPT Version :9

Sequence 1:NP_608619.1 Gene:CG17712 / 33356 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001005600.1 Gene:dhdh.2 / 449558 ZFINID:ZDB-GENE-040927-25 Length:334 Species:Danio rerio


Alignment Length:282 Identity:65/282 - (23%)
Similarity:117/282 - (41%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GVFGTGEIAN---VLVPLLREKGFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVLLRKDVDLV 67
            |:...|:|::   |.:..|:.:..:|.|:..|.|..|:|.|...::.......:::....::|:|
Zfish     6 GICSAGKISHDFTVALRTLQAEQHQVVAVAARELAHAQEFAQKHSIPRAYGSYEELAEDPEIDVV 70

  Fly    68 FI-VCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYYPT-LISLVNHPLRFLPAF 130
            :: ...|. |..:.:..:...|:|:|:||..::.::..:|:.|::.... |:..|  ..||.||.
Zfish    71 YVGTIHPH-HLRVGLLFMNAKKNVLCEKPLAMNLKEVQQMISAARRSDVFLMEAV--WTRFFPAS 132

  Fly   131 THMRRCLQEELIGSIGDVVLMDVRVQMGTLF---PEKYNWMCDAQMGGGALNLVGSVVDLVTFLL 192
            ..:.|.|.:   .::|.|.|  ||...|...   |.    .....:|||||..:|  :..:.|:|
Zfish   133 LEISRLLSQ---NAVGQVKL--VRADFGAALLGVPR----AVQKHLGGGALLDIG--IYCIQFVL 186

  Fly   193 QQQAIRVHGVLRSYTKTTPAINGIR--QITAPDFCNFQMELASGT----LVTVALHSH------- 244
            .                  ..||.:  ||.|...|     |.:|.    :||:....|       
Zfish   187 M------------------VFNGEKPEQIQASGVC-----LDTGVDEAMVVTLKFSGHRLAVCTC 228

  Fly   245 TVPAKAFSQEVLIYGSKGHLVV 266
            ||.|: ...|.||.|::..:.|
Zfish   229 TVAAE-LPNEALIVGTEATIKV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17712NP_608619.1 MviM 5..364 CDD:223745 65/282 (23%)
dhdh.2NP_001005600.1 MviM 1..326 CDD:223745 65/282 (23%)
GFO_IDH_MocA 3..121 CDD:279716 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1924
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.