DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17712 and blvra

DIOPT Version :9

Sequence 1:NP_608619.1 Gene:CG17712 / 33356 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001006896.1 Gene:blvra / 448743 XenbaseID:XB-GENE-1007964 Length:290 Species:Xenopus tropicalis


Alignment Length:220 Identity:49/220 - (22%)
Similarity:86/220 - (39%) Gaps:43/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GVGVFGTGEIANVLVPLLREKGFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVLLRKDVDLVF 68
            |:|:.|:..|.::|.||.......::.|...:.::..:....:.::     :|:.|..||:|..|
 Frog     8 GIGIAGSMRIRDLLNPLQSSPSESLKLIGFVSRRKLDQFNNAKQIE-----LDEALKSKDIDAAF 67

  Fly    69 IVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYYPTLISLVNHPLRFLPAFTHM 133
            |......|.|.....|.:||||:.:.|..|..:.|..:.|.::....::. |.|    :...|..
 Frog    68 ICTDNQNHEESVRHFLEVGKHVLVEYPMALSAEAAYDLWRLAEQKGKVLH-VEH----IELLTEQ 127

  Fly   134 RRCLQEELIGSIGDVVLMDVRVQMGTLFPEKYNWMCDAQMGGGAL--NLVGS-----------VV 185
            .:.|::|:.|.         ::..|.|           ...||.|  ||.|.           :|
 Frog   128 YKQLKKEVQGK---------KLVEGVL-----------HFTGGHLDENLSGFPSFSGIARLSWLV 172

  Fly   186 DLVTFLLQQQAIRVHGVLRSYTKTT 210
            ||...|:...|.|......:|:|.|
 Frog   173 DLFGDLIVTSATREEQKELNYSKLT 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17712NP_608619.1 MviM 5..364 CDD:223745 48/219 (22%)
blvraNP_001006896.1 GFO_IDH_MocA 2..118 CDD:366622 26/115 (23%)
Biliv-reduc_cat 128..240 CDD:370334 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.