DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17712 and CG3597

DIOPT Version :9

Sequence 1:NP_608619.1 Gene:CG17712 / 33356 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001259930.1 Gene:CG3597 / 33420 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster


Alignment Length:362 Identity:77/362 - (21%)
Similarity:143/362 - (39%) Gaps:57/362 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GVFGTGEIANVLVPLL---REKGFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVLLRKDVDLV 67
            |:...|.|....|..|   .:....|.|:.....:.|::.|....:..|.:..|.:.|.::|::|
  Fly    10 GIAAAGRITQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRHYDGFDALALDREVEVV 74

  Fly    68 FI-VCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYYPTLISLVNHP-LRFLPAF 130
            :: ...||.:|.:.: .|..||:|:|:.|..|..:.|.::...::.....:...|.. .||.|::
  Fly    75 YVGTLNPFHYAVVHL-MLARGKNVLCETPMCLSVEQAKELYTLAEQRGVFLMEGNSMWSRFFPSY 138

  Fly   131 THMRRCLQEELIGSIGDVVLMDVRVQMGTLFPEKYNWMCDAQMGGGALNLVGSVVDLVTFLLQQQ 195
            ..:|..|:.::||.:     ..|:||.|........ :|:..:||..|      :|:..:.||..
  Fly   139 DRLRELLKNDVIGEV-----TQVKVQHGFRLAHMER-VCNRSLGGSIL------MDIGIYALQLG 191

  Fly   196 AIRVHGVLRSYTKTTPAINGIRQITAPDFCNFQMELASGTLVTVALHSHTVPAKAFSQEVLIYGS 260
            .. |.||  |..|..|:...:.:.......:|.::...|..: |||   ....:....:.:|.|:
  Fly   192 QF-VFGV--SPVKILPSGTQLNKERVDVQIDFMLDYGDGRRL-VAL---VTGLENLENDAVITGT 249

  Fly   261 KGHL----------VVRGGDLFVLKEGQPKEEAVYVDVQDLHFATNNSLLPRPYIKGLCKMVGAL 315
            ||.:          :.|..   ...|..|...|.:    |.|: ||.           |.:....
  Fly   250 KGEIKLSNYWCCTQISRSN---APPESWPLPRAKF----DFHY-TNT-----------CGLRYEA 295

  Fly   316 KEAFGSKESSWVKAPVSTAATFEDGLYVQAVVEAIRK 352
            :|.....|...:::|..|.|   :.|.:.|:.:.||:
  Fly   296 EEVRRCIEKRLLESPKFTHA---ESLELAAIADEIRR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17712NP_608619.1 MviM 5..364 CDD:223745 77/362 (21%)
CG3597NP_001259930.1 MviM 7..332 CDD:223745 77/362 (21%)
GFO_IDH_MocA 7..127 CDD:279716 25/117 (21%)
GFO_IDH_MocA_C 142..228 CDD:304482 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1924
SonicParanoid 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.