DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17712 and DHDH

DIOPT Version :9

Sequence 1:NP_608619.1 Gene:CG17712 / 33356 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_055290.1 Gene:DHDH / 27294 HGNCID:17887 Length:334 Species:Homo sapiens


Alignment Length:258 Identity:67/258 - (25%)
Similarity:101/258 - (39%) Gaps:46/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GVFGTGEIAN----VLVPLLREKGFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVLLRKDVDL 66
            |:...|.|::    ||..|.|.: .:|.|:..|.|..|||.|...::.......:::.....|::
Human     6 GIVSVGLISSDFTAVLQTLPRSE-HQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEV 69

  Fly    67 VFIVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYYPTLISLVNHPLRFLPAFT 131
            .:|..|...|....:..|..||.|:|:||.|::..:..:|| |......|..:.....||.||..
Human    70 AYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMV-AEARSRALFLMEAIWTRFFPASE 133

  Fly   132 HMRRCLQEELIGSIGDVVLMDVRVQMGTLFPEKYNWMCDAQMGGGALNL---------------- 180
            .:|..|.:   |::||  |...|.:.|.........:..||.||..|::                
Human   134 ALRSVLAQ---GTLGD--LRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQK 193

  Fly   181 ------VG-----SVVDLVTFLLQQQAIRVHG-------VLRSYTKTTPAINGIRQITAPDFC 225
                  ||     .|.|.||.|||... .|||       |..|.|.:.....|:.|:..|.:|
Human   194 PEKISVVGRRHETGVDDTVTVLLQYPG-EVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17712NP_608619.1 MviM 5..364 CDD:223745 67/258 (26%)
DHDHNP_055290.1 MviM 1..326 CDD:223745 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.