DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17712 and Blvra

DIOPT Version :9

Sequence 1:NP_608619.1 Gene:CG17712 / 33356 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_446302.2 Gene:Blvra / 116599 RGDID:620721 Length:295 Species:Rattus norvegicus


Alignment Length:323 Identity:70/323 - (21%)
Similarity:120/323 - (37%) Gaps:97/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GVGVFGTGEIANVLVPLLREK---------GFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVL 59
            ||.|.|.|...:|.:..|::.         ||..|...| :|.|.::.:           ::|.|
  Rat    10 GVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELG-SLDEVRQIS-----------LEDAL 62

  Fly    60 LRKDVDLVFIVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVR-ASQYYPTL----ISL 119
            ..:::|:.:|..:...|.:...:.|..||||:.:.|..|....|.::.. |:|....|    :.|
  Rat    63 RSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVEL 127

  Fly   120 VNHPLRFLPAFTHMRRCLQEELI-GSIGDVVLMDVRVQMGTLFPEKY-----------NWMCDAQ 172
            :.....||     .|..|.:||: ||:        |.....|..|::           .|:... 
  Rat   128 LMEEFEFL-----RREVLGKELLKGSL--------RFTASPLEEERFGFPAFSGISRLTWLVSL- 178

  Fly   173 MGGGALNLVGSVVD--------LVTFLLQQQAIRVHGVLRSYTKTTPAINGIRQITAPDFCNFQM 229
              .|.|:|:.:.::        .:|..|:.|.   .|:|....:..|.:...|      :.||| 
  Rat   179 --FGELSLISATLEERKEDQYMKMTVQLETQN---KGLLSWIEEKGPGLKRNR------YVNFQ- 231

  Fly   230 ELASGTLVTVALHSHTVPAKAFSQEVLIYGSKGHLVVRGGDLFVLK-EGQPKEEAVYVDVQDL 291
             ..||:|                :||...|...::.::..|:||.| .||       |..:||
  Rat   232 -FTSGSL----------------EEVPSVGVNKNIFLKDQDIFVQKLLGQ-------VSAEDL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17712NP_608619.1 MviM 5..364 CDD:223745 69/322 (21%)
BlvraNP_446302.2 GFO_IDH_MocA 18..124 CDD:396129 24/117 (21%)
Biliv-reduc_cat 132..242 CDD:401198 30/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.