DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17712 and dhdh

DIOPT Version :9

Sequence 1:NP_608619.1 Gene:CG17712 / 33356 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001120637.1 Gene:dhdh / 100145807 XenbaseID:XB-GENE-5788276 Length:334 Species:Xenopus tropicalis


Alignment Length:376 Identity:77/376 - (20%)
Similarity:153/376 - (40%) Gaps:89/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GVFGTGEIAN---VLVPLLREKGFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVLLRKDVDLV 67
            |:..||:|:|   |.:..|..:..:|.|:..|.||:|::.|..:.:.......:::....::|::
 Frog     6 GICSTGKISNDFLVALETLPAQDHQVVAVAARDLKQARDFAQIRKIPKAYGSYEELAKDPNIDVI 70

  Fly    68 FIVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYYPTLI--SLVNHPLRFLPAF 130
            ::.....:|.::.:..|...|:|:|:||..::..:..::..|::.|....  :|.:   ||.|.:
 Frog    71 YVGVLHTVHRDVVLMFLQNKKNVLCEKPLAMNSAEVQELTSAARAYNVFFMEALWS---RFFPVY 132

  Fly   131 THMRRCLQEELIGSIGDVVLMDVRVQMGT---LFPEKYNWMCDAQMGGGALNLVGSVVDLVTFLL 192
            ..:|..|.:   .:||||.:  ||.:.|:   ..|.    ....::|||||      :|:..:.:
 Frog   133 EQIRTLLSQ---NAIGDVKV--VRAEFGSNQHHVPR----AVQKELGGGAL------LDIGCYCI 182

  Fly   193 QQQAIRVHGVLRSYTKTTPAINGIR--QITAPDFCNFQMELASGTLVTVALHSHTVPAK------ 249
             |.|:.|             .||.:  .:||.   .|..:......||:.|.   .|.|      
 Frog   183 -QFALMV-------------FNGEKPESVTAK---GFLYDTGVDETVTIILQ---YPGKRQAILT 227

  Fly   250 -----AFSQEVLIYGSKGHLVVRG---GDLFVLKEGQPKEEAVYVDVQDLHFATNNSL------L 300
                 |...:..|.||||.:.|..   ....|:..|:..:..:....:.:||..:..|      :
 Frog   228 CTIMAAMPNQAAICGSKGMIQVPSCMWCPTSVIVNGKETKFPLPHSTKPMHFTNSTGLSYEAEHV 292

  Fly   301 PRPYIKGLCKMVGALKEAFGSKESSWVKAPVSTAATFEDGLYVQAVVEAIR 351
            .:..:|||             |||..::        .:|...:.::::.:|
 Frog   293 RQCLLKGL-------------KESPIMR--------LKDSELLSSIMDEVR 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17712NP_608619.1 MviM 5..364 CDD:223745 77/376 (20%)
dhdhNP_001120637.1 MviM 1..302 CDD:223745 72/346 (21%)
GFO_IDH_MocA 4..121 CDD:279716 24/114 (21%)
GFO_IDH_MocA_C 136..>201 CDD:304482 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1924
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.