DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and FCF1

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_010626.1 Gene:FCF1 / 851939 SGDID:S000002747 Length:189 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:47/168 - (27%)
Similarity:73/168 - (43%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KISRFKKSHKTL------------------VFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQ 48
            |..|.||:.:.:                  :||..|...:.|||||||..|...::|:|:.|...
Yeast    21 KDQRLKKNQENIKTKEDPELTRNIPQVSSALFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRG 85

  Fly    49 IKKYFQCGVKLLTTQCVILESESLGAPLTGATSI-----VKRFHVHKCGHEGKPVPASECIKSMT 108
            :..........|.|.||:.|.|.||.....|..:     :||.   .|.|:|  ..|.:|:....
Yeast    86 MMDCLLAKCNPLITDCVMAELEKLGPKYRIALKLARDPRIKRL---SCSHKG--TYADDCLVHRV 145

  Fly   109 KDNR-YVVASQDRLLQESLRKIPGRCLLYLHKATPVLE 145
            ..:: |:||:.|..|::.:|||||..|:.:.....|:|
Yeast   146 LQHKCYIVATNDAGLKQRIRKIPGIPLMSVGGHAYVIE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 46/166 (28%)
FCF1NP_010626.1 PIN_Fcf1-like 53..183 CDD:350212 41/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.