DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and AT1G26530

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_173975.4 Gene:AT1G26530 / 839193 AraportID:AT1G26530 Length:178 Species:Arabidopsis thaliana


Alignment Length:125 Identity:33/125 - (26%)
Similarity:60/125 - (48%) Gaps:19/125 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKKYFQCGVKLLTTQCVILESESLGAPLTG 78
            :||:.|.....||:||:|..|...::|.||.:::.:..:             :.:..||   ..|
plant    51 LFFSHNSSLVPPYRVLVDTNFINFSIQNKIDLEKGMMVF-------------VRKMHSL---YYG 99

  Fly    79 ATSIVKRFHVHKCGHEGKPVPASEC-IKSMTKDNRYVVASQDRLLQESLRKIPGRCLLYL 137
            ..:...||....|..:|  ..|.:| :..:|:...::||:.||.|:..:|||||..::|:
plant   100 LIAKDPRFERLPCVLKG--TYADDCLVDRVTQHKCFIVATCDRDLKRRIRKIPGVPIMYV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 33/125 (26%)
AT1G26530NP_173975.4 PIN_SF 51..167 CDD:301351 33/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.