DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and MEE21

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_181004.2 Gene:MEE21 / 818021 AraportID:AT2G34570 Length:281 Species:Arabidopsis thaliana


Alignment Length:263 Identity:67/263 - (25%)
Similarity:112/263 - (42%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKISRFKKSHKTLVFFASNFDYREPYQVLIDATFCQAALQQKI-GIDEQIKKYFQCGVKLLTTQC 64
            |::.|.||:.:|:.||...:.:|:||:||.|.||....:..:| ..|..:.:.....|||.||:|
plant     1 MRVKRQKKNRRTVRFFTVCYGFRQPYKVLCDGTFVHHLVTNEITPADTAVSELLGGPVKLFTTRC 65

  Fly    65 VILESESLGAPLTGATSIVKRFHVHKCGHEGKPVPASECIK---SMTKDNRYVVASQD-----RL 121
            ||.|.|.||.....:....:..:...|.|| :...|.||:.   .:.....:.:.:||     :|
plant    66 VIAELEKLGKDFAESLEAAQTLNTATCEHE-EAKTADECLSEVIGVQNTEHFFLGTQDAEFRRKL 129

  Fly   122 LQESLRKIPGRCLLYLHKATPVLEAPS---------KASKKWVQRRAKNLMLGKQVEKIDYMKEK 177
            .|||:  :|   |::..:...:::.||         ..:|:......:..:|.|:..||.....|
plant   130 QQESI--VP---LVFGLRNILLIDQPSDFQRQSAKDSENKRLTMTDTEKKLLVKRTAKIIASNRK 189

  Fly   178 QGLKPAETAVKPK----------------KHKGPKNPNPLSCKKSKKDKAKQQLKGVEQTAITKA 226
            :.....|....|:                |....|.||||||.|.||:..:.:.|....:...|.
plant   190 EATIANEEWGMPRVVSTKNGLGVKDRPQFKRNRAKGPNPLSCMKKKKENPQSKSKADSNSNAQKE 254

  Fly   227 KRK 229
            |::
plant   255 KKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 42/151 (28%)
MEE21NP_181004.2 PIN_Fcf1-Utp23-H 2..148 CDD:189036 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41789
Inparanoid 1 1.050 77 1.000 Inparanoid score I2397
OMA 1 1.010 - - QHG56943
OrthoDB 1 1.010 - - D1364586at2759
OrthoFinder 1 1.000 - - FOG0005224
OrthoInspector 1 1.000 - - oto2823
orthoMCL 1 0.900 - - OOG6_102991
Panther 1 1.100 - - LDO PTHR12416
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3740
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.