DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and Fcf1

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_082908.2 Gene:Fcf1 / 73736 MGIID:1920986 Length:198 Species:Mus musculus


Alignment Length:133 Identity:43/133 - (32%)
Similarity:70/133 - (52%) Gaps:9/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HKTLVFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK--YFQCGVKLLTTQCVILESESL 72
            |.:.:||..|.....||.:|:|..|...:::.|:.:.:.:..  |.:| :..: |.||:.|.|.|
Mouse    51 HPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKC-IPCI-TDCVMAEIEKL 113

  Fly    73 GAPLTGATSIVK--RFHVHKCGHEGKPVPASEC-IKSMTKDNRYVVASQDRLLQESLRKIPGRCL 134
            |.....|..|.|  ||....|.|:|  ..|.:| ::.:|:...|:||:.||.|:..:|||||..:
Mouse   114 GQKFRVALRIAKDPRFDRLPCTHKG--TYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPI 176

  Fly   135 LYL 137
            :||
Mouse   177 MYL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 43/133 (32%)
Fcf1NP_082908.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..47
PIN_Fcf1 55..189 CDD:189034 42/129 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.