DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and Fcf1

DIOPT Version :10

Sequence 1:NP_608617.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_082908.2 Gene:Fcf1 / 73736 MGIID:1920986 Length:198 Species:Mus musculus


Alignment Length:133 Identity:43/133 - (32%)
Similarity:70/133 - (52%) Gaps:9/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HKTLVFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK--YFQCGVKLLTTQCVILESESL 72
            |.:.:||..|.....||.:|:|..|...:::.|:.:.:.:..  |.:| :..: |.||:.|.|.|
Mouse    51 HPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKC-IPCI-TDCVMAEIEKL 113

  Fly    73 GAPLTGATSIVK--RFHVHKCGHEGKPVPASEC-IKSMTKDNRYVVASQDRLLQESLRKIPGRCL 134
            |.....|..|.|  ||....|.|:|  ..|.:| ::.:|:...|:||:.||.|:..:|||||..:
Mouse   114 GQKFRVALRIAKDPRFDRLPCTHKG--TYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPI 176

  Fly   135 LYL 137
            :||
Mouse   177 MYL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_608617.1 PIN_Fcf1-Utp23-H 19..145 CDD:350214 40/124 (32%)
Fcf1NP_082908.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..47
PIN_Fcf1-like 57..187 CDD:350212 41/127 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.