DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and utp23

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_009292730.1 Gene:utp23 / 550514 ZFINID:ZDB-GENE-050417-353 Length:257 Species:Danio rerio


Alignment Length:245 Identity:109/245 - (44%)
Similarity:145/245 - (59%) Gaps:15/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKISRFKKSHKTLVFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKKYFQCGVKLLTTQCV 65
            |||.|.|.:.||:.|:..||.:|||:|:|||.|||||||:.||.|.||:.||....::|.||.|.
Zfish     1 MKIKRQKHAKKTISFYKYNFSFREPFQILIDGTFCQAALKNKIQIKEQLPKYLMGEIQLCTTNCA 65

  Fly    66 ILESESLGAPLTGATSIVKRFHVHKCGHEGKPVPASECIKSM---TKDNRYVVASQDRLLQESLR 127
            :.|.|||...|.||..|::||.:.||.|...|||||||:.||   |..:.|.:|:||:.|..:|:
Zfish    66 LKELESLAKDLYGAKLILQRFQIRKCKHMKDPVPASECLLSMLAETNPHHYFIATQDQQLTTALK 130

  Fly   128 KIPGRCLLYLHKATPVLEAPSKASKKWVQRRAKNLMLGK-----QVEKIDYMKEKQGLK-PAETA 186
            ||||..|||:...|.||:.||:.:.|.|:.    :.||:     |.:.:..:|||:|:. .||..
Zfish   131 KIPGVPLLYIILNTMVLDKPSERTLKHVEA----VQLGEIVNPAQQKSLQSLKEKEGISGDAEKR 191

  Fly   187 VKPKKHKGPKNPNPLSCKKSKKDKA-KQQLKGVEQTAITKAKRKRVKIPA 235
            .:.:|.| ..|||||||.|.||.|| .||.|..:.....|..|.|...||
Zfish   192 GRKRKRK-QSNPNPLSCLKKKKKKATPQQPKNPDGEKKRKRSRHRKHKPA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 72/145 (50%)
utp23XP_009292730.1 PIN_Fcf1-Utp23-H 2..148 CDD:189036 72/145 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580144
Domainoid 1 1.000 83 1.000 Domainoid score I8320
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41789
Inparanoid 1 1.050 178 1.000 Inparanoid score I4027
OMA 1 1.010 - - QHG56943
OrthoDB 1 1.010 - - D1364586at2759
OrthoFinder 1 1.000 - - FOG0005224
OrthoInspector 1 1.000 - - oto39406
orthoMCL 1 0.900 - - OOG6_102991
Panther 1 1.100 - - LDO PTHR12416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3740
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.