DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and Bka

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster


Alignment Length:133 Identity:39/133 - (29%)
Similarity:67/133 - (50%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK--YFQCGVKLLTTQCVILESESLGAPL 76
            :||..|.....||.:::|..|...:::.|:.|.:.:..  |.:|...:  :.||..|.|.||...
  Fly    58 LFFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYI--SDCVRAELEKLGNKY 120

  Fly    77 TGATSIVK--RFHVHKCGHEGKPVPASECIKSMTKDNR-YVVASQDRLLQESLRKIPGRCLLYL- 137
            ..|..|:.  ||....|.|:|  ..|.:|:....:.:: |:||:.|:.|:..:|||||..::|: 
  Fly   121 KLALRIISDPRFERLPCLHKG--TYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVA 183

  Fly   138 -HK 139
             ||
  Fly   184 AHK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 39/133 (29%)
BkaNP_524867.2 PIN_Fcf1 58..192 CDD:189034 39/133 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1412
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.