DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and Bka

DIOPT Version :10

Sequence 1:NP_608617.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_524867.2 Gene:Bka / 46032 FlyBaseID:FBgn0010520 Length:200 Species:Drosophila melanogaster


Alignment Length:133 Identity:39/133 - (29%)
Similarity:67/133 - (50%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK--YFQCGVKLLTTQCVILESESLGAPL 76
            :||..|.....||.:::|..|...:::.|:.|.:.:..  |.:|...:  :.||..|.|.||...
  Fly    58 LFFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYI--SDCVRAELEKLGNKY 120

  Fly    77 TGATSIVK--RFHVHKCGHEGKPVPASECIKSMTKDNR-YVVASQDRLLQESLRKIPGRCLLYL- 137
            ..|..|:.  ||....|.|:|  ..|.:|:....:.:: |:||:.|:.|:..:|||||..::|: 
  Fly   121 KLALRIISDPRFERLPCLHKG--TYADDCLVERVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVA 183

  Fly   138 -HK 139
             ||
  Fly   184 AHK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_608617.1 PIN_Fcf1-Utp23-H 19..145 CDD:350214 37/128 (29%)
BkaNP_524867.2 PIN_Fcf1-like 60..190 CDD:350212 38/131 (29%)

Return to query results.
Submit another query.