DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and fcf1

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001004999.1 Gene:fcf1 / 448479 XenbaseID:XB-GENE-968525 Length:197 Species:Xenopus tropicalis


Alignment Length:129 Identity:41/129 - (31%)
Similarity:67/129 - (51%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK--YFQCGVKLLTTQCVILESESLGAPL 76
            :||..|.:...||.:|:|..|...:::.|:.:.:.:..  |.:| |..: |.||:.|.|.||...
 Frog    54 LFFQYNTNLGPPYYILVDTNFINFSIKAKLDLVQSMMDCLYAKC-VPCI-TDCVMAELEKLGQKY 116

  Fly    77 TGATSIVK--RFHVHKCGHEGKPVPASEC-IKSMTKDNRYVVASQDRLLQESLRKIPGRCLLYL 137
            ..|..|.|  .|....|.|.|  ..|.:| ::.:|:...|:||:.||.|:..:|||||..::|:
 Frog   117 RVALRIAKDPSFERLPCSHPG--TYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 41/129 (32%)
fcf1NP_001004999.1 PIN_Fcf1-like 56..186 CDD:350212 40/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.