DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and C34E10.10

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_498110.1 Gene:C34E10.10 / 175715 WormBaseID:WBGene00016411 Length:232 Species:Caenorhabditis elegans


Alignment Length:237 Identity:85/237 - (35%)
Similarity:128/237 - (54%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKISRFKKSHKTLVFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKKYFQCGVKLLTTQCV 65
            ||:.|.|::::.|.|:..|:.:..||:||:|.|||.||||:|:.:.|||.||......|:||.||
 Worm     1 MKVKRLKRANRLLTFYKYNYKFVAPYRVLVDGTFCNAALQEKLNLAEQIPKYLTEETHLMTTNCV 65

  Fly    66 ILESESLGAPLTGATSIVKRFHVHKCGHEGKPVPASECIKSMTK-----DNRYVVASQDRLLQES 125
            :.|.|..|..|.||..|.|:|.:.:|.| ..|..||:|:..:.:     ..:|::|:||..|.|.
 Worm    66 LKELEKFGPLLYGAFVIAKQFEIAECTH-STPRAASDCLAHLARRAASGKTKYLIATQDDELTEK 129

  Fly   126 LRKIPGRCLLYLHKATPVLEAPSKASKKWVQRRAKNLMLGKQVEKIDYMKEKQGLKPAETAVKPK 190
            ||.|.|..::|:...|.:|:..|:|:|..         ..|:..:|..:||.:.....:..:|.|
 Worm   130 LRAIVGTPIMYIKFKTVLLDNISEATKAG---------CSKEESEIKKLKELKNALIGQQELKKK 185

  Fly   191 KHKGPKNPNPLSCKKSKKDKAKQQLKGVEQTAITKAKRKRVK 232
            |.|  |..|||||||.....:...::..|:||  ..||||.|
 Worm   186 KKK--KGVNPLSCKKKIMKASVDIVRTGERTA--SGKRKRTK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 56/147 (38%)
C34E10.10NP_498110.1 PIN_Fcf1-Utp23-H 2..149 CDD:189036 56/147 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158949
Domainoid 1 1.000 59 1.000 Domainoid score I7081
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41789
Inparanoid 1 1.050 136 1.000 Inparanoid score I3134
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56943
OrthoDB 1 1.010 - - D1364586at2759
OrthoFinder 1 1.000 - - FOG0005224
OrthoInspector 1 1.000 - - oto19687
orthoMCL 1 0.900 - - OOG6_102991
Panther 1 1.100 - - LDO PTHR12416
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5577
SonicParanoid 1 1.000 - - X3740
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.