DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17652 and F30A10.9

DIOPT Version :9

Sequence 1:NP_001259881.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_492523.1 Gene:F30A10.9 / 172780 WormBaseID:WBGene00009266 Length:196 Species:Caenorhabditis elegans


Alignment Length:153 Identity:39/153 - (25%)
Similarity:69/153 - (45%) Gaps:33/153 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKISRFKKSHKTLVFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKKYFQC---GVKLLTT 62
            :|:.|..|. .:.:|...|.....|:.|::|..|...|::.:|   :..:.:..|   ...:..|
 Worm    42 LKLVRAPKI-SSAMFMKYNTQLGPPFHVIVDTNFVNFAVKNRI---DMFQGFMDCLFAKTIVYAT 102

  Fly    63 QCVILESESLGAPLTGATSIVKRFHVH------------KCGHEGKPVPASEC-IKSMTKDNRYV 114
            .||:.|.|.           |:||.:.            ||.|:|  ..|.:| ::.:|:...|:
 Worm   103 DCVLAELEK-----------VRRFKIALKVLKDPRVQRLKCEHKG--TYADDCLVQRVTQHKCYI 154

  Fly   115 VASQDRLLQESLRKIPGRCLLYL 137
            ||:.||.|:..:|||||..::|:
 Worm   155 VATCDRDLKRRIRKIPGVPIMYI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17652NP_001259881.1 PIN_Fcf1-Utp23-H 2..145 CDD:189036 39/152 (26%)
F30A10.9NP_492523.1 PIN_Fcf1-like 57..185 CDD:350212 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1412
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.