DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eno and eno3

DIOPT Version :9

Sequence 1:NP_722721.1 Gene:Eno / 33351 FlyBaseID:FBgn0000579 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001027497.1 Gene:eno3 / 613089 XenbaseID:XB-GENE-6454723 Length:434 Species:Xenopus tropicalis


Alignment Length:433 Identity:316/433 - (72%)
Similarity:363/433 - (83%) Gaps:1/433 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 MTIKAIKARQIYDSRGNPTVEVDLTTELGLFRAAVPSGASTGVHEALELRDNDKANYHGKSVLKA 132
            |:|..|.||:|.||||||||||||.|..||||||||||||||::|||||||.||:.|.||.||||
 Frog     1 MSILKIHAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKSRYLGKGVLKA 65

  Fly   133 VGHVNDTLGPELIKANLDVVDQASIDNFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPL 197
            |.|:|.|:.|.|::..|.||:|..||..|::||||||||||||||||||||||.|||||:||:||
 Frog    66 VDHINKTIVPALLEKKLSVVEQEKIDKVMLELDGTENKSKFGANAILGVSLAVCKAGAAEKGIPL 130

  Fly   198 YKHIADLAGNKEIILPVPAFNVINGGSHAGNKLAMQEFMILPTGATSFTEAMKMGSEVYHHLKNV 262
            |:||||||||||:|||||||||||||||||||||||||||||.||.:|.|||::|:||||:||.|
 Frog   131 YQHIADLAGNKELILPVPAFNVINGGSHAGNKLAMQEFMILPVGAATFHEAMRIGAEVYHNLKAV 195

  Fly   263 IKAKFGLDATAVGDEGGFAPNIQSNKEALNLISDAIAKAGYTGKIEIGMDVAASEFYKDGQYDLD 327
            ||||:|.|||.|||||||||||..|.|||.|:..||.||||..||.|||||||||||:.|:||||
 Frog   196 IKAKYGKDATNVGDEGGFAPNILENNEALELLKAAIEKAGYPDKIVIGMDVAASEFYRKGKYDLD 260

  Fly   328 FKNEKSDKSQWLPADKLANLYQEFIKDFPIVSIEDPFDQDHWEAWSNLTGCTDIQIVGDDLTVTN 392
            ||: ..|.::::..:||.:||:.|||.:|:||||||||||.|:.|.:.....|||||||||||||
 Frog   261 FKS-PDDPNRYISGEKLGDLYKSFIKSYPVVSIEDPFDQDDWDTWKSFLSSVDIQIVGDDLTVTN 324

  Fly   393 PKRIATAVEKKACNCLLLKVNQIGTVTESIAAHLLAKKNGWGTMVSHRSGETEDSFIGDLVVGLS 457
            ||||...||:||||||||||||||:|||||.|..||:.||||.|||||||||||:||.||||||.
 Frog   325 PKRIQKGVEQKACNCLLLKVNQIGSVTESIQACKLAQTNGWGVMVSHRSGETEDTFIADLVVGLC 389

  Fly   458 TGQIKTGAPCRSERLAKYNQILRIEEEIGAGVKFAGKSFRKPQ 500
            ||||||||||||||||||||::|||||:||..||||::||.|:
 Frog   390 TGQIKTGAPCRSERLAKYNQLMRIEEELGAKAKFAGRNFRNPR 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EnoNP_722721.1 PLN00191 69..499 CDD:215095 314/429 (73%)
enolase 72..484 CDD:239429 303/411 (74%)
eno3NP_001027497.1 PLN00191 2..431 CDD:215095 314/429 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 435 1.000 Domainoid score I566
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 641 1.000 Inparanoid score I805
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000613
OrthoInspector 1 1.000 - - otm48909
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X347
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.