DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Allc

DIOPT Version :10

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_444386.2 Gene:Allc / 94041 MGIID:2136971 Length:414 Species:Mus musculus


Alignment Length:43 Identity:10/43 - (23%)
Similarity:18/43 - (41%) Gaps:10/43 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETMV 239
            ||:...:.: ..:|:      ||...|   .|..:||..|.::
Mouse    14 LDFTQLIDL-ASECV------GGKVLF---ATDDFFGPAENLI 46

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:395101
Mito_carr 163..253 CDD:395101 10/43 (23%)
Mito_carr 268..355 CDD:395101
AllcNP_444386.2 allantoicase 18..386 CDD:274363 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.