DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and ANT1

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_015453.1 Gene:ANT1 / 856246 SGDID:S000006332 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:348 Identity:77/348 - (22%)
Similarity:147/348 - (42%) Gaps:67/348 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRK 72
            ||...:.|..|..:..:...||::.||.:||.   ::||. :|::..|                 
Yeast     3 TLESALTGAVASAMANIAVYPLDLSKTIIQSQ---VSPSS-SEDSNEG----------------- 46

  Fly    73 LSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVG 137
               .:|.||                         :..::|.|:.:|.:.:|...|::|:....|.
Yeast    47 ---KVLPNR-------------------------RYKNVVDCMINIFKEKGILGLYQGMTVTTVA 83

  Fly   138 VAPSRAIYFCTY-----SQTKNTLNSL-GFVERDSPLV-----HIMSAASAGFVSSTATNPIWFV 191
            ......:||..|     |..|:.|..| ....||.|:.     .::...:|..:|...|:|:..|
Yeast    84 TFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEELVLGVAAASISQLFTSPMAVV 148

  Fly   192 KTRMQLDYNSKVQMTVRQCIERVYAQ--GGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQ 254
            .||.|..:::: .......|:.:|.:  |.:.||:||:..   |:..|:...:.|...: :|.|.
Yeast   149 ATRQQTVHSAE-SAKFTNVIKDIYRENNGDITAFWKGLRT---GLALTINPSITYASFQ-RLKEV 208

  Fly   255 RNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEGR 319
            ....|::..||...::..:.|.:||.|::.:..|..||:..|:..|:|:.:|.:.|..::|.||.
Yeast   209 FFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALLYLYKNEGL 273

  Fly   320 AGLYRGLATQLVRQIPNTAIMMA 342
            ..|::|:..||.:.:....::.|
Yeast   274 KSLWKGVLPQLTKGVIVQGLLFA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 29/152 (19%)
Mito_carr 163..253 CDD:278578 22/96 (23%)
Mito_carr 268..355 CDD:278578 20/75 (27%)
ANT1NP_015453.1 Mito_carr 3..106 CDD:395101 29/151 (19%)
Mito_carr 218..305 CDD:395101 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.