DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and DAL2

DIOPT Version :10

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_012295.1 Gene:DAL2 / 854847 SGDID:S000001468 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:25/113 - (22%)
Similarity:35/113 - (30%) Gaps:34/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 HIVQNEGPRALFKGLGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAG--- 178
            ||:..|...|.|.|.....|.:   .|:|  ...:..|      .||.||..|.|:.....|   
Yeast    94 HIIGGEIDTAFFNGNHAPFVSI---EALY--DEGEEGN------IVEDDSRWVEIVEKFECGPSQ 147

  Fly   179 ---FVSSTATNPIWFVKTRMQLDYNSKVQMTVRQCIERVYAQGGVAAF 223
               ||.........|...::                 ::|..||:|.|
Yeast   148 RHLFVRGNGLTKERFTHIKL-----------------KMYPDGGIARF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:395101 10/38 (26%)
Mito_carr 163..253 CDD:395101 14/67 (21%)
Mito_carr 268..355 CDD:395101
DAL2NP_012295.1 allantoicase 21..343 CDD:274363 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.