DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and DAL2

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_012295.1 Gene:DAL2 / 854847 SGDID:S000001468 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:25/113 - (22%)
Similarity:35/113 - (30%) Gaps:34/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 HIVQNEGPRALFKGLGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAG--- 178
            ||:..|...|.|.|.....|.:   .|:|  ...:..|      .||.||..|.|:.....|   
Yeast    94 HIIGGEIDTAFFNGNHAPFVSI---EALY--DEGEEGN------IVEDDSRWVEIVEKFECGPSQ 147

  Fly   179 ---FVSSTATNPIWFVKTRMQLDYNSKVQMTVRQCIERVYAQGGVAAF 223
               ||.........|...::                 ::|..||:|.|
Yeast   148 RHLFVRGNGLTKERFTHIKL-----------------KMYPDGGIARF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 10/38 (26%)
Mito_carr 163..253 CDD:278578 14/67 (21%)
Mito_carr 268..355 CDD:278578
DAL2NP_012295.1 Alc 1..343 CDD:355631 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.