DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and PNC2

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_198104.1 Gene:PNC2 / 832812 AraportID:AT5G27520 Length:321 Species:Arabidopsis thaliana


Alignment Length:310 Identity:70/310 - (22%)
Similarity:130/310 - (41%) Gaps:69/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LSTTIL------RNRSQPQV-IGGVRRIMAISHC---GISSTTPKSMSIVQCLRHIVQNEGPRAL 127
            ||||||      :::.|.:: :.|.::...:|..   .|||....|                  |
plant    22 LSTTILYPLDTCKSKFQAEIRVRGQQKYRYLSDVFWEAISSGNVLS------------------L 68

  Fly   128 FKGLGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERD-SPLVHIMSAASAGFVSSTATNPIWFV 191
            ::|||...:....|..|||.:||..|. |:|.....:. ....:::.||:||..:|..|.|:...
plant    69 YQGLGTKNLQSFISSFIYFYSYSYFKR-L
HSQRIGSKSIGTKANLLIAAAAGACTSVLTQPLDTA 132

  Fly   192 KTRMQLDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRN 256
            .:|||.....|     .:.:.:....|.....:.|:..|........:.:.:::.:|..|||:..
plant   133 SSRMQTSEFGK-----SKGLWKTLTDGSWGNAFDGLGISLLLTSNPAIQYTVFDQLKQNLLEKGK 192

  Fly   257 QRHTDTKGSRD--------FLEFMMAGAVSKTIASCIAYP----------------HEVARTRLR 297
                 .|.::|        |:.|:: |||||:.|:.|.||                :|..:.|.|
plant   193 -----AKSNKDSSPVVLSAFMAFVL-GAVSKSAATVITYPAIRCKVMIQAADDSKENEAKKPRKR 251

  Fly   298 EEGNKYNSFWQTLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAV 347
            ..    .:....::.:||:||..|.::||..|:::.:.::|:::...|.:
plant   252 IR----KTIPGVVYAIWKKEGILGFFKGLQAQILKTVLSSALLLMIKEKI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 24/92 (26%)
Mito_carr 163..253 CDD:278578 16/90 (18%)
Mito_carr 268..355 CDD:278578 24/96 (25%)
PNC2NP_198104.1 Mito_carr 6..96 CDD:395101 24/92 (26%)
Mito_carr 110..191 CDD:395101 18/85 (21%)
Mito_carr 204..297 CDD:395101 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.