DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and PNC1

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_566251.1 Gene:PNC1 / 819693 AraportID:AT3G05290 Length:322 Species:Arabidopsis thaliana


Alignment Length:360 Identity:68/360 - (18%)
Similarity:142/360 - (39%) Gaps:97/360 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAGGSAGTVGAVVTC----PLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKL 73
            ::..::|.:|::::.    ||:..|::.|:...               |.|.|       :.|.|
plant     8 VSEATSGAIGSLLSTTILYPLDTCKSKFQAEVR---------------ARGQQ-------KYRYL 50

  Fly    74 STTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGV 138
            |..:....|:.||.                                      :|::|||......
plant    51 SDVMWEAISKGQVF--------------------------------------SLYQGLGTKNFQS 77

  Fly   139 APSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLDYNSKV 203
            ..|:.|||.:||..|...:.....:......:::.||:||..:|....|:....:|||..     
plant    78 FISQFIYFYSYSYFKRV
HSERTGSKSIGTKANLLIAAAAGACTSVLIQPLDTASSRMQTS----- 137

  Fly   204 QMTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRD- 267
            :....:.:.:...:|..|..:.|:..|........:.:.:::.:|..||:|:|.:..:  ||.. 
plant   138 EFGESKGLWKTLTEGSWADAFDGLGISLLLTSNPAIQYTVFDQLKQHLLKQKNAKAEN--GSSPV 200

  Fly   268 ----FLEFMMAGAVSKTIASCIAYP----------------HEVARTRLREEGNKYNSFWQTLHT 312
                |:.|:: |||||::|:.:.||                :|..:.|.|..    .:....::.
plant   201 VLSAFMAFVL-GAVSKSVATVLTYPAIRCKVMIQAADESKENETKKPRRRTR----KTIPGVVYA 260

  Fly   313 VWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAV 347
            :|::||..|.::||..|:::.:.::|:::...|.:
plant   261 IWRKEGMLGFFKGLQAQILKTVLSSALLLMIKEKI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 26/146 (18%)
Mito_carr 163..253 CDD:278578 15/89 (17%)
Mito_carr 268..355 CDD:278578 22/96 (23%)
PNC1NP_566251.1 Mito_carr 4..94 CDD:395101 26/145 (18%)
Mito_carr 108..189 CDD:395101 16/85 (19%)
Mito_carr 202..295 CDD:395101 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.