DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and NDT1

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_566102.1 Gene:NDT1 / 819362 AraportID:AT2G47490 Length:312 Species:Arabidopsis thaliana


Alignment Length:359 Identity:99/359 - (27%)
Similarity:156/359 - (43%) Gaps:86/359 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NTADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPE 68
            |:.:.|.:..||.:||.|.|...|||:|:|||.|                               
plant     9 NSKNVLCNAAAGAAAGVVAATFVCPLDVIKTRFQ------------------------------- 42

  Fly    69 QRRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGP 133
                              :.|:.:        :.....|...||..|..|.:.||.|.|::||.|
plant    43 ------------------VHGLPK--------LGDANIKGSLIVGSLEQIFKREGMRGLYRGLSP 81

  Fly   134 NLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPL---VHIMSAASAGFVSSTATNPIWFVKTRM 195
            .::.:..:.||||..|.|.|:.|.|     .|..|   .::::|:.||..::.||||:|.||||:
plant    82 TVMALLSNWAIYFTMYDQLKSFLCS-----NDHKLSVGANVLAASGAGAATTIATNPLWVVKTRL 141

  Fly   196 Q--------LDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLL 252
            |        :.|.|..     ..:.|:..:.|:...|.|:..:..||....:.|..||.|| ..|
plant   142 QTQGMRVGIVPYKSTF-----SALRRIAYEEGIRGLYSGLVPALAGISHVAIQFPTYEMIK-VYL 200

  Fly   253 EQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGN----KYNSFWQTLHTV 313
            .::..:..|...:||   ..:|.:::|..||.:.|||||.|.||:|:|:    :|:.....:..|
plant   201 AKKGDKSVDNLNARD---VAVASSIAKIFASTLTYPHEVVRARLQEQGHHSEKRYSGVRDCIKKV 262

  Fly   314 WKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAV 347
            ::::|..|.|||.||.|:|..|...|...::|.|
plant   263 FEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 35/147 (24%)
Mito_carr 163..253 CDD:278578 28/100 (28%)
Mito_carr 268..355 CDD:278578 29/84 (35%)
NDT1NP_566102.1 Mito_carr <29..104 CDD:395101 28/131 (21%)
Mito_carr <129..204 CDD:395101 24/80 (30%)
Mito_carr 218..303 CDD:395101 29/79 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.