DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and SLC25A32

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_110407.2 Gene:SLC25A32 / 81034 HGNCID:29683 Length:315 Species:Homo sapiens


Alignment Length:347 Identity:93/347 - (26%)
Similarity:144/347 - (41%) Gaps:70/347 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLST 75
            :||||.|.|.:..:...||::||.|...|...                    ||           
Human    25 NLIAGVSGGVLSNLALHPLDLVKIRFAVSDGL--------------------EL----------- 58

  Fly    76 TILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAP 140
                                         .||...|:.||..|.:.:|.|.|::|:.||:.|...
Human    59 -----------------------------RPKYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGL 94

  Fly   141 SRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLDYNSKVQM 205
            |..:||..|:..| :..:.|..||.....:::|||.||.::...|||:|..|||:.|.|::.|..
Human    95 SWGLYFFFYNAIK-SYKTEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYDAVVNS 158

  Fly   206 TVRQ------CIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKG 264
            ..||      .:.::|...||...|||.....||.....:.|:.||.:|.|..:..|:.   .:.
Human   159 PHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKYNQHINRL---PEA 220

  Fly   265 SRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEGRAGLYRGLATQ 329
            ....:|::...|:||..|....||::|.|.||:::...|:.....:...|::||..|.|:|:|..
Human   221 QLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGVGGFYKGIAPN 285

  Fly   330 LVRQIPNTAIMMATYEAVVYVL 351
            |:|..|...|....||.|.:.|
Human   286 LIRVTPACCITFVVYENVSHFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 32/144 (22%)
Mito_carr 163..253 CDD:278578 32/95 (34%)
Mito_carr 268..355 CDD:278578 27/84 (32%)
SLC25A32NP_110407.2 Solcar 1 20..109 32/144 (22%)
Mito_carr 26..307 CDD:332982 92/344 (27%)
Solcar 2 118..209 29/90 (32%)
Solcar 3 222..306 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 1 1.010 - - D404957at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.