DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and slc25a36b

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_686599.4 Gene:slc25a36b / 558307 ZFINID:ZDB-GENE-080219-28 Length:311 Species:Danio rerio


Alignment Length:358 Identity:176/358 - (49%)
Similarity:220/358 - (61%) Gaps:56/358 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQNTADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELL 65
            |:|.  |||:||.|||..|||||::||||||||||||||:..:..|.:                 
Zfish     1 MSQR--DTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSITLCISEV----------------- 46

  Fly    66 RPEQRRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKG 130
                  .|||                    ::...::...|...  :.|||.|::.||||:||:|
Zfish    47 ------HLST--------------------VNGASVARVAPPGP--LHCLRIILEKEGPRSLFRG 83

  Fly   131 LGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRM 195
            |||||:||||||||||..||..|..||.:  .|.||..:|:.||..|||.:.|||||||.:|||:
Zfish    84 LGPNLIGVAPSRAIYFAAYSSAKEKLNCV--FEPDSTGLHMASAGIAGFTAITATNPIWLIKTRL 146

  Fly   196 QLDYNSKVQ--MTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQR 258
            |||..|:.:  |...:|:.|||...||..||:|::|||.||.||::||||||.||.:|.|.:...
Zfish   147 QLDARSRGERRMNAFECVRRVYQTDGVRGFYRGMSASYAGISETVIHFVIYESIKRRLSEAKAAT 211

  Fly   259 HTD-----TKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEG 318
            |.:     .|.:.||:..|:|.|.|||.|:||||||||.||||||||.||.||:|:|:.|.:||.
Zfish   212 HMNEDEDRAKSASDFVGMMLAAATSKTCATCIAYPHEVIRTRLREEGTKYRSFFQSLNLVIQEES 276

  Fly   319 RAGLYRGLATQLVRQIPNTAIMMATYEAVVYVL 351
            ...|||||.|.||||||||||||.|||.|||:|
Zfish   277 YRALYRGLTTHLVRQIPNTAIMMCTYEFVVYLL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 60/147 (41%)
Mito_carr 163..253 CDD:278578 49/91 (54%)
Mito_carr 268..355 CDD:278578 58/84 (69%)
slc25a36bXP_686599.4 Mito_carr 2..109 CDD:278578 62/153 (41%)
PTZ00169 5..290 CDD:240302 156/331 (47%)
Mito_carr 114..206 CDD:278578 49/91 (54%)
Mito_carr 226..305 CDD:278578 54/78 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5762
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 313 1.000 Inparanoid score I2555
OMA 1 1.010 - - QHG53601
OrthoDB 1 1.010 - - D1372287at2759
OrthoFinder 1 1.000 - - FOG0002320
OrthoInspector 1 1.000 - - otm24946
orthoMCL 1 0.900 - - OOG6_103444
Panther 1 1.100 - - O PTHR45829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1747
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.