DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and ALLC

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_016859984.1 Gene:ALLC / 55821 HGNCID:17377 Length:459 Species:Homo sapiens


Alignment Length:94 Identity:25/94 - (26%)
Similarity:38/94 - (40%) Gaps:14/94 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GT-VGAVVTCP--LEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTILRN 80
            || .||..| |  .|.:........:::.|  :.|...|.||:|....|:..:||    .|.:|.
Human   177 GTRTGAAAT-PEEFEAIAELKSDDWSYLVP--MTELKPGNPASGHNYFLVNSQQR----WTHIRL 234

  Fly    81 RSQPQVIGGVR--RIMAISHCGISSTTPK 107
            ...|.  ||:.  |:........::|.||
Human   235 NIFPD--GGIARLRVFGTGQKDWTATDPK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 25/94 (27%)
Mito_carr 163..253 CDD:278578
Mito_carr 268..355 CDD:278578
ALLCXP_016859984.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.