DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and ALLC

DIOPT Version :10

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_016859984.1 Gene:ALLC / 55821 HGNCID:17377 Length:459 Species:Homo sapiens


Alignment Length:94 Identity:25/94 - (26%)
Similarity:38/94 - (40%) Gaps:14/94 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GT-VGAVVTCP--LEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTILRN 80
            || .||..| |  .|.:........:::.|  :.|...|.||:|....|:..:||    .|.:|.
Human   177 GTRTGAAAT-PEEFEAIAELKSDDWSYLVP--MTELKPGNPASGHNYFLVNSQQR----WTHIRL 234

  Fly    81 RSQPQVIGGVR--RIMAISHCGISSTTPK 107
            ...|.  ||:.  |:........::|.||
Human   235 NIFPD--GGIARLRVFGTGQKDWTATDPK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:395101 25/94 (27%)
Mito_carr 163..253 CDD:395101
Mito_carr 268..355 CDD:395101
ALLCXP_016859984.1 allantoicase 67..434 CDD:274363 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.