Sequence 1: | NP_608615.1 | Gene: | Rim2 / 33350 | FlyBaseID: | FBgn0031359 | Length: | 365 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016859984.1 | Gene: | ALLC / 55821 | HGNCID: | 17377 | Length: | 459 | Species: | Homo sapiens |
Alignment Length: | 94 | Identity: | 25/94 - (26%) |
---|---|---|---|
Similarity: | 38/94 - (40%) | Gaps: | 14/94 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 GT-VGAVVTCP--LEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTILRN 80
Fly 81 RSQPQVIGGVR--RIMAISHCGISSTTPK 107 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rim2 | NP_608615.1 | Mito_carr | 8..156 | CDD:278578 | 25/94 (27%) |
Mito_carr | 163..253 | CDD:278578 | |||
Mito_carr | 268..355 | CDD:278578 | |||
ALLC | XP_016859984.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |