DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and aralar1

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:371 Identity:90/371 - (24%)
Similarity:139/371 - (37%) Gaps:115/371 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTILR 79
            |..||.|||.|..|:::||||:|:..|   .|.:.|.|                         .|
  Fly   361 GSFAGAVGATVVYPIDLVKTRMQNQRA---GSYIGEVA-------------------------YR 397

  Fly    80 NRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSRAI 144
            |.                              ..|.:.:|::||...|::||.|.|:||||.:||
  Fly   398 NS------------------------------WDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAI 432

  Fly   145 YFCTYSQTKNTLNSLGFVERDS---------PLVHIMSAASAGFVSSTATNPIWFVKTRMQ---- 196
                    |.|:|.|   .||.         ....:::...||......|||:..||.|:|    
  Fly   433 --------KLTVNDL---VRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGE 486

  Fly   197 LDYNSKVQ--MTVRQCIERVYAQGGVAAFYKGITASYF-GICETMVHFVIYEFIKSKLLEQRNQR 258
            :...||::  ..||:.        |:...|||..|... .:..:.::|..|...|:.:.::....
  Fly   487 IASGSKIRAWSVVREL--------GLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYN 543

  Fly   259 HTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRL----REEGNKYNSFWQTLHTVWKEEGR 319
            |.        |..:.|||::...|:.:..|.:|.:|||    |.....|...|.....:..|||.
  Fly   544 HP--------LTLLAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEGP 600

  Fly   320 AGLYRGLATQLVRQIPNTAIMMATYEAVVYVLTRRFNNKSNEFYDF 365
            ...::|.|.::.|..|...:.:.|||    :|.|.|      :.||
  Fly   601 RAFWKGTAARVFRSSPQFGVTLVTYE----LLQRLF------YVDF 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 35/140 (25%)
Mito_carr 163..253 CDD:278578 23/105 (22%)
Mito_carr 268..355 CDD:278578 25/90 (28%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 40/155 (26%)
PTZ00169 358..631 CDD:240302 86/358 (24%)
Mito_carr 449..539 CDD:278578 21/97 (22%)
Mito_carr 544..633 CDD:278578 27/106 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.