DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and CG7943

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:275 Identity:65/275 - (23%)
Similarity:106/275 - (38%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CG-----ISSTTPKSMSIVQCLRHIV---------QNEGPRALFKGLGPNLVGVAPSRAIYFCTY 149
            ||     |:.|.|....|.:.:.|.|         ::||...|::|:.|.|.....|.:|.|..:
  Fly    61 CGAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGVF 125

  Fly   150 SQTKN------TLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLDYNSKVQM--- 205
            ..|:.      .||..|        ..:::|..||...|... |...|:|.:.   :||...   
  Fly   126 DGTRRYLVEDY
RLNDYG--------AKVLAAVVAGSAESILL-PFERVQTLLA---DSKFHQHFS 178

  Fly   206 TVRQCIERVYAQGGVAAFYKGITASYF--GICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRDF 268
            ..:.....|.:..|....|:|:...::  |:...: .||:.|....:|.::::   ..|:..::|
  Fly   179 NTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNAL-FFVLREEASVRLPKRK
S---VSTRTVQEF 239

  Fly   269 LEFMMAGAVSKTIASCIAYPHEVARTRLREE-GNKYNSFWQTLHTVWKEEGR--AGLYRGLATQL 330
            :    ||||.....|.|.||..|.:..|:.| |.:....||....::.|..|  ...|||.....
  Fly   240 I----AGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQACKRIYVERDRRIGNFYRGCPFNT 300

  Fly   331 VRQIPNTAIMMATYE 345
            .|...:..||...||
  Fly   301 GRSFISWGIMNTAYE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 18/76 (24%)
Mito_carr 163..253 CDD:278578 18/94 (19%)
Mito_carr 268..355 CDD:278578 25/81 (31%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/74 (24%)
Mito_carr 141..229 CDD:278578 19/100 (19%)
Mito_carr 235..322 CDD:278578 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.