DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and mfrn

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:352 Identity:84/352 - (23%)
Similarity:135/352 - (38%) Gaps:85/352 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQ 69
            |....:::.||..||.:..||..||:.||||:||                               
  Fly    11 TTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQS------------------------------- 44

  Fly    70 RRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPN 134
                                           :|..| |:|:||..||.::..||.....:|....
  Fly    45 -------------------------------LSPPT-KNMNIVSTLRTMITREGLLRPIRGASAV 77

  Fly   135 LVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLDY 199
            ::|..|:.::||..|..||........|..   |.:::|.|.|..:....::|...:|.|||: |
  Fly    78 VLGAGPAHSLYFAAYEMTKELTAKFTSVRN---LNYVISGAVATLIHDAISSPTDVIKQRMQM-Y 138

  Fly   200 NSKVQMTVRQCIERVYAQGGVAAFYKGI-TASYFGICETMVHFVIYEFIKSKLLEQRNQR---HT 260
            ||.....| .|:..:|.:.|..|||:.. |.....:....:||..|||.::|:..:|...   | 
  Fly   139 NSPYTSVV-SCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNPPVH- 201

  Fly   261 DTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLR-EEGNKYNSFWQTLHTVWKEEGRAGLYR 324
                       |.|||.:...|:.:..|.:|.:|.|. :|........:....::...|..|.:|
  Fly   202 -----------MAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKIYHMAGPLGFFR 255

  Fly   325 GLATQLVRQIPNTAIMMATYEAVVYVL 351
            |...:::..:|.|||..:|||...:.|
  Fly   256 GTTARVLYSMPATAICWSTYEFFKFYL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 32/147 (22%)
Mito_carr 163..253 CDD:278578 26/90 (29%)
Mito_carr 268..355 CDD:278578 22/85 (26%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 32/147 (22%)
PTZ00168 17..280 CDD:185494 82/342 (24%)
Mito_carr 107..190 CDD:278578 25/87 (29%)
Mito_carr <215..282 CDD:278578 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.