DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and GC2

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:355 Identity:80/355 - (22%)
Similarity:138/355 - (38%) Gaps:98/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTT 76
            :|.||.||.:|.....||::||||||:.|.             || ||           .::.| 
  Fly    24 IINGGVAGIIGVACVYPLDMVKTRLQNQTI-------------GP-NG-----------ERMYT- 62

  Fly    77 ILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPS 141
                                             ||..|.|..:.:||...:::|...|:|.:.|.
  Fly    63 ---------------------------------SIADCFRKTIASEGYFGMYRGSAVNIVLITPE 94

  Fly   142 RAIYFCTYSQTKNTLNSL--GFVERDSPLVHIMSAASAGFVSS----TATNPIWFVKTRMQLDYN 200
            :||        |.|.|..  ..:..|..::.:..|..||.::.    ..|.|:..:|.:||  ..
  Fly    95 KAI--------KLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQ--DA 149

  Fly   201 SKVQMTVRQC---IERVYAQG---------GVAAFYKGITASYFGICE---TMVHFVIYEFIKSK 250
            .:|....|..   ::.:.|.|         |:...|||:.|:  |:.:   :||:|.:..:|   
  Fly   150 GRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGAT--GVRDITFSMVYFPLMAWI--- 209

  Fly   251 LLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEG-NKYNSFWQTLHTVW 314
              ..:..|.:|..|...|...::||.:|...::.:..|.:|.:|||:.:| .|:......::...
  Fly   210 --NDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQADGEKKFKGIMDCVNRTL 272

  Fly   315 KEEGRAGLYRGLATQLVRQIPNTAIMMATY 344
            ||||.:..::|...:::...|...|....|
  Fly   273 KEEGISAFFKGGLCRIMVLAPLFGIAQMFY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 33/143 (23%)
Mito_carr 163..253 CDD:278578 23/108 (21%)
Mito_carr 268..355 CDD:278578 19/78 (24%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 77/340 (23%)
Mito_carr 16..106 CDD:278578 35/148 (24%)
Mito_carr 123..203 CDD:278578 19/83 (23%)
Mito_carr 228..302 CDD:278578 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.