DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and GC1

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:298 Identity:74/298 - (24%)
Similarity:117/298 - (39%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRL-------------AENAGGGPANGGQSE 63
            :|.||.||.:|.....||::||||||:........|:             ||...|.....|.:.
  Fly    25 IINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNI 89

  Fly    64 LL-RPEQ----------RRKLSTTILRNRSQP----QVIGGVR---------------------- 91
            || .||:          |.||:|   ::...|    .|.||:.                      
  Fly    90 LLITPEKAIKLTANDYFRHKLTT---KDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAG 151

  Fly    92 RIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSRAIYFCTYSQTKNTL 156
            |:.|.:.  ::..|.:.:|..|....:::::|...|:||:|...:.......|||..::    ||
  Fly   152 RVAAAAK--LAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFA----TL 210

  Fly   157 NSLGFVERDSP-----LVHIMSAASAGFVSSTATNPIWFVKTRMQLDYNS---KVQMTVRQCIER 213
            |.||....|..     ....::..:||..::.|.||...||||:|....:   |....:..||.:
  Fly   211 NDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGISDCITK 275

  Fly   214 VYAQGGVAAFYKG------ITASYFGICETMVHFVIYE 245
            .....|..||:||      :.|..|||.:|:.:..:.|
  Fly   276 TLKHEGPTAFFKGGLCRMIVIAPLFGIAQTVYYLGVAE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 44/193 (23%)
Mito_carr 163..253 CDD:278578 25/97 (26%)
Mito_carr 268..355 CDD:278578
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 21/79 (27%)
Mito_carr 115..213 CDD:278578 20/103 (19%)
Mito_carr 226..307 CDD:278578 23/80 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.