DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and CG16736

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:182 Identity:41/182 - (22%)
Similarity:77/182 - (42%) Gaps:33/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VSSTA---TNPIWFVKTRMQLDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGIC-----E 236
            :.:||   ::|:..|:..||.:.....::::.... |:.|:.|:..||.||.|:    |     .
  Fly     9 IKTTAQLLSHPMELVRVNMQANVIHHSRLSINHMF-RLMARHGLPGFYYGIVAA----CLRCTVH 68

  Fly   237 TMVHFVIYEFIKSK----LLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLR 297
            ||..:.::..::..    :|:..|.  :...|...|.     |.|..|..:.:|...:...||..
  Fly    69 TMSTYTLFYNLQD
NKYVLMLQPYNT--SMVLGITGFW-----GGVLATPFAKLAVIRQADLTRGS 126

  Fly   298 EEGNKYNSFWQTLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAVVY 349
            .|...|.:||:.|..::.:.|...|:.|..   :..|.:||:      ||:|
  Fly   127 YERRNYRNFWRGLKCMYAKGGFTYLFTGWK---INSISSTAV------AVLY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578
Mito_carr 163..253 CDD:278578 17/84 (20%)
Mito_carr 268..355 CDD:278578 21/82 (26%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 17/76 (22%)
Mito_carr 187..277 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441976
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.