DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and CG6893

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:301 Identity:67/301 - (22%)
Similarity:115/301 - (38%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTP------------KSMSIVQCLRHIVQNE 122
            :|.:.|..:|.|.....:.|     ||:.|   .|.|            |...:...|:..::..
  Fly     6 KRVIKTKKIRPRWWSGGVAG-----AIAQC---FTAPFDLIEARMVVIKKDRGMASNLQQAIRTH 62

  Fly   123 GPRALFKGLGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSP---LVHIMSAASAGFVSSTA 184
            |..:|:.||...|:     |.:   ||:..:..|..:|....|.|   |..::.||.||.|:...
  Fly    63 GFISLYDGLSAQLL-----RQL---TYTSMRFHLYEMGKEHLDDPAGLLDKVLVAALAGCVAGVV 119

  Fly   185 TNPIWFVKTRMQLD--------YNSKVQMTVRQCIERVYAQGGVAAFYKGITASYF-GICETMVH 240
            ..|:..:.||||::        :|.:   .|...:.||..:.|....|.|...|:. ....|:..
  Fly   120 GTPMELINTRMQVNRALPKETRWNYR---NVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQ 181

  Fly   241 FVIYEFIKSKLLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVAR-TRLREEGNKYN 304
            ...|:..|....|..:.:|.:|      |..:::...:..:...|..|.|..| .|:.:.....|
  Fly   182 NAAYDQAKQIYAEFFHMKHDNT------LLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLIN 240

  Fly   305 SFWQTLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYE 345
            |.     :.....|..|.:||:...::|.:|||.|...::|
  Fly   241 SI-----SYMMRFGSRGPFRGMVPYVLRMVPNTVITFLSFE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 20/97 (21%)
Mito_carr 163..253 CDD:278578 24/101 (24%)
Mito_carr 268..355 CDD:278578 18/79 (23%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 18/91 (20%)
Mito_carr 98..192 CDD:395101 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.